TPT
Total:
$0.00
Selected
Subjects
Prices

Subjects

Arts & Music
English Language Arts
Foreign Language
Holidays/Seasonal
Math
Science
Social Studies - History
Specialty
For All Subject Areas
5,857 results

Reading flash cards $5-10

Preview of Sight Words Practice with Decodable Sentences Cards with Assessments BUNDLE

Sight Words Practice with Decodable Sentences Cards with Assessments BUNDLE

You understand the importance of sight words and decoding practice! These high frequency word flashcards help children read sight words in isolation and in decodable sentences! Every card helps readers improve their word recognition, fluency, and decoding skills! They are perfect for guided reading, reading lessons, and homework. Click on the preview to see what makes these cards so special!Reading research supports learning new sight words within a sentence. What is included?400 sight word card
Preview of ABC Big Flashcards w/ Movements

ABC Big Flashcards w/ Movements

Created by
Lisaelaine
ABC Big Flashcards with optional backside with letter, movement explanation, and keyword. A-Z, short and long vowel sounds, both sounds for c,g,s,x and all 4 sounds of y included. **Letters on top!A-apple,apronB-board, ball (2 options)C-cat, circle (both sounds of c)D-dogE-edge, eagleF-front teeth, fish (2 options)G-guitar, giraffe (both sounds of g)H- heartI- igloo, iceJ- jacketK- keyL- lionM- monkey, meal (2 options)N-noseO-octopus, openP- pig, push (2 options)Q-queenR- rainbowS- snake, dogs (
Preview of Classroom Library Labels, Editable Book Bin Labels, Genre Labels

Classroom Library Labels, Editable Book Bin Labels, Genre Labels

These classroom library labels are perfect for organizing your classroom library for grades 1-6. The colors and visuals on each label will bring your book bins to life for your growing readers! There is a lot of flexibility included in this resource to fit the needs of your particular classroom library. It includes all subjects and genre labels in both a white or black background. In addition, an editable PowerPoint file is included (plain or with generic reading clipart) for any additional subj
Preview of Feature and Function Task Cards

Feature and Function Task Cards

Enhancing linguistic organization, discrimination, and vocabulary, these task cards assist in identifying items by their features or functions, supporting various IEP goals. The extensive examples, diverse feature/function types, and variety foster an enjoyable and enriching practice environment for students. Ideal for independent work, guided practice, stations, or therapy sessions, this resource includes 72 Feature Function Cards, complete with labels for convenient storage.Check out our other
Preview of Sight Word Sentence Flashcards and Assessment System

Sight Word Sentence Flashcards and Assessment System

Created by
Brenda Tejeda
Looking for an easy way to assess and keep track of your students' sight word knowledge? Need an effective, fun way for them to practice their sight words? This pack is for you!⭐️⭐⭐️⭐️⭐️ “I loved these sight word cards as an alternative to just the sight word on a card. I loved that the word was used in context and this allowed students to use more strategies than just memorization to read the word. “ -Telena H.Part of a bundle that includes 6 sight word packs OR part of a huge growing bundle th
Preview of Two Letter Consonant Blends BIG Flashcards

Two Letter Consonant Blends BIG Flashcards

Created by
Lisaelaine
Two Letter Consonant Blends BIG Flashcards-22 Blends Flashcards Front: letters and keyword pictureBack: letters, sound, movement explanation, and keywordBlends included:blclflglplslbrcrdrfrgrprtrscskslsmsnspstswtw
Preview of Heart Word Flash Cards | Dolch Sight Words| High Frequency Words

Heart Word Flash Cards | Dolch Sight Words| High Frequency Words

Help your students learn how to read those tricky high frequency words using heart words! This resource includes 220 flash cards with visuals and are perfect for your Kindergarten, 1st, and 2nd grade students!Check out the preview to get a closer look at this product!What are Heart Words?Heart words are high-frequency words where some part of the word is irregularly spelled. This irregular part must be taught explicitly and memorized by “heart”. This product includes:A downloadable PDF file220 F
Preview of Editable Flashcard Template

Editable Flashcard Template

Editable Flashcards Template Make your own flashcards with this quick and easy template! Each flashcard size and border is already formatted so that all you have to do is type each word that you would like! This editable file includes five different flashcard sizes to choose from and use in your classroom! These cards have the same design and font as the Fry sight word flashcards that I sell in my store! I have had many requests for an editable template so that teachers can add their students na
Preview of Wh- Question Bingo

Wh- Question Bingo

Elevate language skill development for learners with language impairment through our engaging Bingo games tailored for special education and autistic students. These games provide targeted practice in answering who, what, where, when, and why questions, fostering successful responses with the help of visuals and structured formats. With each game dedicated to a specific question type, students can focus on identifying response patterns effectively. The Wh- Mix Up game, covering who, what, where,
Preview of Sight Word Practice with Decodable Sentences | High Frequency Words Set 1

Sight Word Practice with Decodable Sentences | High Frequency Words Set 1

You understand the importance of sight word practice! These sight word flashcards help children read high frequency words in isolation and in decodable sentences! Every card helps readers improve their word recognition, fluency, and decoding skills! They are perfect for guided reading, reading lessons, and homework. Click on the preview to see what makes these cards so special!Reading research supports new learning sight words within a sentence. What is included?250 sight word cards with decodab
Preview of Letter Cards | Letter Sound Review | High Frequency Words | Structured Literacy

Letter Cards | Letter Sound Review | High Frequency Words | Structured Literacy

Research shows that consistent review of previously taught skills and concepts is one of the BEST ways to ensure kids master foundational literacy skills. This resource includes EVERYTHING you need to implement an engaging, quick and effective review routine. These letter cards, high-frequency word cards, assessments and progress monitoring sheets are a perfect addition to your whole group, small group, or online learning instruction. This Resource Includes: Over 190 Printable Phoneme-Grapheme C
Preview of Phonics Flashcards - Letters, Blends, Digraphs, Diphthongs, Vowel Teams & More

Phonics Flashcards - Letters, Blends, Digraphs, Diphthongs, Vowel Teams & More

In need of some phonics flashcards for your review, instruction, or sound wall? Use these phonics flashcards to review phonetic concepts, hang them up for reference, or use them as headings for a sound wall. Each card includes letters, a corresponding picture, and the word of the image with the letter(s) in red. Check out the preview to learn more! Includes over 170 cards.Phonics Flashcards Included...Alphabet cards (uppercase/lowercase together on the same card)DigraphsSounds of YMagic e with v
Preview of Listening Comprehension Sentences {With 210 Comprehension Questions!}

Listening Comprehension Sentences {With 210 Comprehension Questions!}

Created by
Peachie Speechie
Have fun targeting listening comprehension skills with your students! Each card contains 1 sentence and 2 comprehension questions about the sentence - 210 total comprehension questions!This product contains an assortment of Who, What, When, Where, Why, and How questions. How to use this product: Print and cut out cards (laminate if desired)SLP/Teacher reads the sentences on the card aloud and then asks the comprehension questions about the sentenceThe student answers the questions :)Note: There
Preview of Decoding Drills for Fluency - Short Vowel Edition - Science of Reading Aligned

Decoding Drills for Fluency - Short Vowel Edition - Science of Reading Aligned

Decoding Drills for Fluency Check out the BUNDLE for a discount on ALL Decoding Drills resources!Short Vowel Decoding Drills are here! After learning a new phonics skill, students need to apply that skill in word reading. ---------------------------------------------------------------------------------------------------------------------------- --DISTANCE LEARNING UPDATE - August 17, 2020--- ***I have now added DIGITAL versions of these Short Vowel Decoding Drills that have been formatted for us
Preview of Category Task Cards

Category Task Cards

Enhancing vocabulary, linguistic organization, and discrimination skills, these task cards foster advanced categorization targeted at various IEP goals. The "Name the Category" cards focus on recognizing diverse items in advanced categories like vehicles, tools, and furniture, while the "What Doesn't Belong" cards develop critical thinking by identifying non-examples within a group. These resources aim to nurture the ability to compare and contrast items. Ideal for therapy sessions, guided pract
Preview of CVC BLENDING FLASH CARDS- Teach Reading

CVC BLENDING FLASH CARDS- Teach Reading

Created by
Jady Alvarez
These are 52 flash cards word in the front, picture in the back. Three letter words CVC- Consonant Vowel Consonant. The pack brings the most 8 common word families represented in the set. The word families in this set are: at, an, am, ag, ap, et, ug, ot, ig. All five vowels are included. The vowels are in red so that the child can focus on elongating the vowels in red to make blending easier! This is an excellent way to practice blending with preschool, kindergarten and 1st grade students! You
Preview of Wh-Question Task Card Set

Wh-Question Task Card Set

Enhancing wh-question skills—answering who, what, where, when, and why—is pivotal for learners' holistic development. These task cards are designed to build conversation, comprehension, vocabulary, and academic knowledge, crucial for academic and functional growth. This resource covers a broad spectrum of wh-questions, offering diverse examples and varieties to engage students and enhance their vocabulary in an enjoyable and practical manner.Perfect for speech therapy, direct instruction, statio
Preview of Sight Word Notebook and Fluency Sentences | Fluency, Practice, Management

Sight Word Notebook and Fluency Sentences | Fluency, Practice, Management

Created by
Hollie Griffith
This sight word notebook is PERFECT to individualize and mange the instruction of high frequency words and heart words. How does the sight word notebook work?You teach students to orthographically map sight words. The sight word notebook gives students extra practice reading each word and reading the words in context to develop fluency.The sight word notebook helps you easily manage individualized sight word instruction. With this notebook (or mini-books), all students have the opportunity to le
Preview of WH Questions - 100 Task Cards (WHO | WHAT | WHERE | WHEN | WHY)

WH Questions - 100 Task Cards (WHO | WHAT | WHERE | WHEN | WHY)

Created by
Raven Education
These 100 Task Cards are excellent practice for students learning how to answer WH Questions. Understanding, and answering wh questions is an important skill to have. These task cards can be used independently, during 1-on-1 instruction or even with a partner! Students can read (or be read) the question on the card and then select their answer by pointing, circling, placing a small manipulative on the card. What Is Included?20 WHO Question Cards20 WHAT Question Cards20 WHERE Question Cards20 WHE
Preview of Parts of a Book - Worksheets & Vocabulary Cards

Parts of a Book - Worksheets & Vocabulary Cards

In this Parts of a Book set you will find 16 worksheets and 2 sets of vocabulary cards that cover the basics of print and the names of parts of a book. They also cover who an author and illustrator are and what their job is in making a book.Use these resources to reinforce and follow-up on the lessons you teach and model about the parts of a book. Kids will be enchanted with the fun pictures on the worksheets and the common sense of how a book works. Little did they know that each part of a book
Preview of Phonics Card Games for Decoding Nonsense Words Bundle for Nonsense Word Fluency

Phonics Card Games for Decoding Nonsense Words Bundle for Nonsense Word Fluency

Created by
Tammys Toolbox
These crazy phonics card games use the science of reading to help kids who need extra practice with nonsense word decoding strategies and syllable division rules. In Crazy Words, players must read single-syllable nonsense words to get rid of their cards. And in Crazy Nonsense Words 2 - Multisyllable Edition, players must use decoding skills to read multisyllable nonsense words correctly. Both games are great for providing practice with syllable division rules, syllable types, and decoding skills
Preview of Sight Word Worksheets - High Frequency Word Writing & Memorization - Editable

Sight Word Worksheets - High Frequency Word Writing & Memorization - Editable

Sight words are the high-frequency words you want your students to know automatically when reading. You've done an amazing job coaching your kindergarten, first grade, and second-grade students in class, but is it enough? What if you had an engaging homework practice activity? This sight word activity can be homework practice activity, center activity, or partner or independent learning activity that strengthens your students' reading confidence and makes them sight word masters.This Sight Word
Preview of Inferencing Paragraphs Card Deck

Inferencing Paragraphs Card Deck

Created by
Peachie Speechie
Paragraphs with questions to target inferencing skills! This product includes 30 paragraphs and 30 accompanying answer cards that explain the clues in the paragraph and talk the student through the process of making an inference. That's 60 cards total! Because of the accompanying answer cards, this product can easily be used for centers or independent practice or group work. Great for small groups during speech therapy sessions. This product targets inferencing skills without visual support, so
Preview of Orton Gillingham Scope and Sequence, Phoneme Card Deck & Editable Lesson plan

Orton Gillingham Scope and Sequence, Phoneme Card Deck & Editable Lesson plan

This Orton Gillingham bundle includes an Orton Gillingham scope and sequence, an editable Orton Gillingham lesson plan & a printable phoneme card deck. This bundle is the MUST-HAVE for any Orton Gillingham tutor!The phonics card deck includes:every single phoneme taught in the Orton Gillingham scope and sequence5 common prefixesthe most common 28 suffixes!!! Card Deck Layout:The front of the card shows the grapheme (letter) and the back shows order of frequency, alternate spellings, and wo
Showing 1-24 of 5,857 results

Find Reading resources | TPT

Learn more about reading resources

Not only is reading a core concept in the study of English language arts, but it’s also a cornerstone skill for proficiency in many other subjects (for instance, without strong reading skills, students won’t be able to solve math word problems or read through primary sources for social studies class).

If you’re a teacher or parent looking for printable and digital reading resources to help your student learn a reading concept, look no further! TPT has an extensive collection of resources, created by other teachers, that are designed to help with any need across grade levels.

Elementary students just learning to read can practice the basics with some simple, fun phonics practice activities or small-group reading centers focused around sight words. Students in middle and high school can read novels and complete hands-on, interactive assignments that build their comprehension and critical thinking skills. With plenty of TPT resources at your fingertips, you can sharpen your student's reading skills in no time.

Fun and engaging reading activities to try

Engaging reading activities can energize your students and foster a love of reading. Here are a few ideas for reading activities from our teacher-created resources that you can find on TPT and try in your classroom:

Interactive Phonics Activities

Use hands-on activities such as sorting, matching, or building words with manipulatives to help students recognize phonics patterns and learn word families.

Word Hunts

Encourage students to find specific words either in a text or around the classroom to help reinforce sight word recognition.

Reader's Theater

Bring short stories, books, poems, or plays you’re reading in class to life by assigning roles to students and having them act out scenes. This can help enhance fluency and comprehension.

Interactive Read-Alouds

Engage the class by pausing during read-alouds to discuss the story’s theme, reflect on a character’s motivations or actions, or to ask students questions.

Comparative Analysis

Explore different adaptations of the same story (book versus movie, classic version versus a modern retelling) to encourage analysis of interpretation and presentation. You can also pair texts that are similar in theme, like poems and songs.

By incorporating these (and other!) reading activities into your lesson plans, you can nurture a love for reading while enhancing comprehension, critical thinking, and communication skills.

Frequently asked questions about teaching reading

What types of reading resources are available on TPT?

There are many different types of reading resources sold by Sellers on TPT. Some popular reading lessons include: phonics, vocabulary, spelling, and balanced literacy.

How do I find reading lessons on TPT?

Educators can save time preparing reading lessons with resources created by experienced teachers. Simply start a search for reading resources on the TPT marketplace, and filter by grade level, price, and/or resource type to find materials that've been proven to work in classrooms like yours. No matter what you’re teaching, there are plenty of reading lessons and activities sold by Sellers on TPT that are tailored to meet your students' skill levels.

How can I make my reading lessons fun and engaging?

Students learn best when they're engaged! Sprinkle a little fun into your reading lessons by using manipulatives, pairing unusual texts like poems and short films together, or doing an escape room activity.